Anti-TAT antibody produced in rabbit

The immunogen for anti-TAT antibody: synthetic peptide derected towards the C terminal of human TAT

Tat catalyzes the conversion of L-tyrosine and 2-oxoglutarate to 4-hydroxyphenylpyruvate and L-glutamate; It is involved in gluconeogenesis.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.