콘텐츠로 건너뛰기
Merck

HPA045910

Anti-CRBN antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-MRT2, Anti-MRT2A

조직 및 계약 가격을 보려면 로그인를 클릭합니다.

크기 선택

보기 변경

제품정보 (DICE 배송 시 비용 별도)

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
31
기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CRBN(51185)

General description

The gene CRBN (cereblon) is mapped to human chromosome 3p26.2. It is strongly expressed in the brain. The encoded protein has a conserved Lon (ATP-dependent protease La) domain. The CRBN protein is present in the cytoplasm and nucleus.
CRBN protein interacts with:

Immunogen

cereblon recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CRBN antibody produced in rabbit has been used in western blotting.
Anti-CRBN antibody produced in rabbit has been used in immunohistochemistry

Biochem/physiol Actions

CRBN (cereblon) mainly recruits substrates for E3 ubiquitin ligase. It interacts with BKCa (calcium-activated potassium channel subunit α-1), ClC-2 (chloride channel protein 2), AMPK (5′-AMP-activated protein kinase), PSMB4 (proteasome subunit β 4), ikaros (IKZF1), aiolos (IKZF3) and MEIS2 (Meis1-related protein). These interactions might be required for sending the proteins for ubiquitination by the E3 ubiquitin ligase. Degradation of IKZF1 (ikaros family zinc finger protein 1) and IKZF3 by lenalidomide (immunomodulatory drug)-bound CRBN helps in anti-myeloma effect of lenalidomide. Similarly, treatment with thalidomide in CRBN positive cells is effective in elderly patients with multiple myeloma. CRBN might also be associated with autosomal recessive nonsyndromic intellectual disability.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST79292

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

제품 선택 도구}를 사용하여 선택의 폭을 좁혀보세요.


저장 등급

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our 문서 section.

도움이 필요하시면 연락하세요. 고객 지원 부서

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문



Immunomodulatory drugs disrupt the cereblon-CD147-MCT1 axis to exert antitumor activity and teratogenicity.
Eichner R, et al.
Nature Medicine, 22, 735-735 (2016)
Dolores Del Prete et al.
The Journal of biological chemistry, 291(33), 17209-17227 (2016-06-22)
The amyloid precursor protein (APP), whose mutations cause Alzheimer disease, plays an important in vivo role and facilitates transmitter release. Because the APP cytosolic region (ACR) is essential for these functions, we have characterized its brain interactome. We found that
Thalidomide-based induction regimens are as effective as bortezomib-based regimens in elderly patients with multiple myeloma with cereblon expression.
Jung SH, et al.
Annals of Hematology, 95, 1645-1651 (2016)



국제 무역 품목 번호

SKUGTIN
HPA045910-100UL04061837130694
HPA045910-25UL04061841500179