WH0009693M1
Monoclonal Anti-RAPGEF2 antibody produced in mouse
clone 1E8, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-CNrasGEF, Anti-PDZGEF1, Anti-RAGEF, Anti-Rap GEP, Anti-Rap guanine nucleotide exchange factor (GEF) 2, Anti-RapGEP
Select a Size
About This Item
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1E8, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RAPGEF2(9693)
General description
Immunogen
Sequence
PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV
Physical form
Legal Information
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service