SAB5702822
Anti-NPHS2 Antibody, clone 2O10G3, Rabbit Monoclonal
Synonym(s):
PDCN, SRN1
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.46
biological source
rabbit
Quality Level
conjugate
unconjugated
material
colorless
clone
2O10G3, monoclonal
form
liquid
mol wt
35 kDa
species reactivity
human
concentration
1.2 mg/mL
technique(s)
western blot: 1:500 - 1:2000
color
colorless
isotype
IgG
immunogen sequence
AQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NPHS2(7827)
General description
This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 284-383 of human NPHS2 (Q9NP85).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.
Application
WB
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service