SAB5702417
Anti-iNOS Antibody, clone 3L0U6, Rabbit Monoclonal
Synonym(s):
HEP-NOS, INOS, NOS, NOS2A
Select a Size
About This Item
biological source
rabbit
Quality Level
conjugate
unconjugated
material
colorless
clone
3L0U6, monoclonal
form
liquid
mol wt
130 kDa
species reactivity
mouse
concentration
3 mg/mL
technique(s)
immunofluorescence: 1:50 - 1:200
western blot: 1:500 - 1:2000
color
colorless
isotype
IgG
immunogen sequence
ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NOS2(4843)
General description
Immunogen
Application
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service