Skip to Content
MilliporeSigma

SAB5702120

Sigma-Aldrich

Anti-TRAF6BP/TAX1BP1 Antibody, clone 7Y9W3, Rabbit Monoclonal

Synonym(s):

CALCOCO3, T6BP, TXBP151

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.46
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

material

colorless

clone

7Y9W3, monoclonal

form

liquid

mol wt

100 kDa

species reactivity

rat, rat, human

concentration

1.28 mg/mL

technique(s)

western blot: 1:500 - 1:2000

color

colorless

isotype

IgG

immunogen sequence

DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TAX1BP1(8887)

General description

This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 690-789 of human TRAF6BP/TAX1BP1 (Q86VP1).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service