Skip to Content
MilliporeSigma

SAB5702069

Sigma-Aldrich

Anti-β-Tubulin III Antibody

rabbit monoclonal, 6X6H6

Synonym(s):

CDCBM,CDCBM1,CFEOM3,CFEOM3A,FEOM3,TUBB4,beta-4,beta Tubulin III,TUBB3

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.46
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-βIII-Tubulin Antibody, clone 6X6H6, Rabbit Monoclonal,

biological source

rabbit

Quality Level

material

colorless

clone

6X6H6, monoclonal

form

liquid

mol wt

50 kDa

species reactivity

rat, rat, human

concentration

0.33 mg/mL

technique(s)

immunofluorescence: 1:50 - 1:200
immunoprecipitation (IP): 1:50 - 1:200
western blot: 1:500 - 1:2000

color

colorless

isotype

IgG

immunogen sequence

VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TUBB3(10381)

General description

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Oct 2010]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin/β3-Tubulin (Q13509).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC, IP

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service