Skip to Content
MilliporeSigma

SAB5702060

Sigma-Aldrich

Anti-ARPC2 Antibody, clone 4F2G6, Rabbit Monoclonal

Synonym(s):

ARPC2, ARC34, PNAS-139, PRO2446, p34-Arc, actin-related protein 2/3 complex subunit 2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.46
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

material

colorless

clone

4F2G6, monoclonal

form

liquid

mol wt

34 kDa

species reactivity

rat, rat, human

concentration

0.40 mg/mL

technique(s)

immunofluorescence: 1:50 - 1:200
immunoprecipitation (IP): 1:50 - 1:200
western blot: 1:500 - 1:2000

color

colorless

isotype

IgG

immunogen sequence

FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARPC2(10109)

General description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC, IP

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service