SAB5702042
Anti-DNA topoisomerase I (TOP1) Antibody, clone 3D4W6, Rabbit Monoclonal
Synonym(s):
TOPI
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
material
colorless
clone
3D4W6, monoclonal
form
liquid
mol wt
100 kDa
species reactivity
human, rat, rat
concentration
0.33 mg/mL
technique(s)
immunofluorescence: 1:50 - 1:200
immunohistochemistry: 1:50 - 1:200
immunoprecipitation (IP): 1:50 - 1:200
western blot: 1:500 - 1:2000
color
colorless
isotype
IgG
immunogen sequence
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TOP1(7150)
General description
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq, Jul 2008]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.
Application
WB, IHC, IF/ICC, IP
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service