SAB2108800
Anti-Vtn antibody produced in rabbit FITC conjugated
affinity isolated antibody
Synonym(s):
ADCA, MGC26418, PENKB, SCA23
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.45
biological source
rabbit
conjugate
FITC conjugate
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
mol wt
52 kDa
species reactivity
rat
species reactivity (predicted by homology)
zebrafish, human, bovine, goat, guinea pig, rabbit, mouse, canine, horse
concentration
0.5 mg/mL
NCBI accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... VTN(7448)
General description
Vtn may act as a cofactor for plasminogen activator inhibitor 1 (PAI-1) inhibition of thrombin.
Immunogen
Synthetic peptide directed towards the middle region of Rat Vtn
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Other Notes
Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service