SAB2102397
Anti-TCF7L2 (ab2) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-TCF4, Anti-Transcription factor 7-like 2 (T-cell specific, HMG-box)
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
65 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TCF7L2(6934)
Immunogen
Synthetic peptide directed towards the middle region of human TCF7L2
Biochem/physiol Actions
The TCL7L2 is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. suggested that TCL7L2 acts through regulation of proglucagon through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway. The TCL7L2 gene product is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. (2005) [PubMed 15525634] suggested that TCL7L2 acts through regulation of proglucagon (MIM 138030) through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway.[supplied by OMIM]. Sequence Note: This gene (TCF7L2, alias TCF-4) is distinct from TCF4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-202 DA473655.1 1-202 203-251 Y11306.2 3-51 252-1252 AK225809.1 256-1256 1253-1305 Y11306.2 1053-1105 1306-1756 AK225809.1 1310-1760 1757-1811 Y11306.2 1557-1611 1812-2652 AK225809.1 1765-2605
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service