SAB1412412
ANTI-BMP5 antibody produced in mouse
clone 3D10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
BMP5, MGC34244
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3D10, monoclonal
form
buffered aqueous solution
mol wt
antigen 36.74 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
application(s)
research pathology
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... BMP5(653)
General description
This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. (provided by RefSeq)
Immunogen
BMP5 (NP_066551.1, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
Sequence
VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service