Skip to Content
MilliporeSigma

SAB1409909

Sigma-Aldrich

Monoclonal Anti-GCM1 antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

GCMA, hGCMa

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3G5, monoclonal

form

buffered aqueous solution

mol wt

antigen 36.19 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GCM1(8521)

Immunogen

GCM1 (NP_003634, 26 a.a. ~ 121 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLK

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Parallel genotyping of 10,204 single nucleotide polymorphisms to screen for susceptible genes for IgA nephropathy.
Woo KT
Annals of the Academy of Medicine, Singapore, 38, 894-894 (2009)
A Positive Feedback Loop between Glial Cells Missing 1 and Human Chorionic Gonadotropin (hCG) Regulates Placental hCG? Expression and Cell Differentiation.
Cheong ML
Molecular and Cellular Biology, 36, 197-197 (2015)
GATA3 inhibits GCM1 activity and trophoblast cell invasion.
Chiu YH and Chen H
Scientific Reports, 6, 21630-21630 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service