Skip to Content
MilliporeSigma

SAB1405227

Sigma-Aldrich

Monoclonal Anti-POLD4 antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

POLDS, p12

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C11, monoclonal

form

buffered aqueous solution

mol wt

antigen ~29.85 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POLD4(57804)

General description

Mammalian DNA polymerase (Pol) δ contains four subunits, p125, p50, p68, and p12. DNA polymerase δ 4, accessory subunit (POLD4) is the smallest subunit of DNA polymerase δ. POLD4 gene is located on human chromosome 11q13.2.

Immunogen

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Biochem/physiol Actions

Mammalian DNA polymerase (Pol) δ plays a key role in DNA replication. DNA polymerase δ 4, accessory subunit (POLD4) is involved in cell cycle progression. It helps to maintain the genomic stability of human cells. p12 is essential for the optimal activity of human Pol δ. p12 helps to stabilize Pol holoenzyme. Interaction of p12 with PCNA also aids in stabilizing the Pol-proliferating cell nuclear antigen (PCNA) complex. Lower expression of the POLD4 gene might participate in the progression of lung cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Melanie Haas Kucherlapati
Oncotarget, 10(65), 6913-6933 (2019-12-21)
Genes of the pre-replication, pre-initiation and replisome complexes duplicate the genome from many sites once in a normal cell cycle. This study examines complex components in lung adenocarcinoma (LUAD) closely, correlating changes in the genome and transcriptome with proliferation and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service