SAB1402250
Monoclonal Anti-LAMP2 antibody produced in mouse
clone 2G10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
CD107b, LAMPB, LGP110
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2G10, monoclonal
form
buffered aqueous solution
mol wt
antigen ~36.89 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LAMP2(3920)
General description
The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. (provided by RefSeq) Lysosome-associated membrane protein 2 (LAMP2) is expressed in the lysosomal lumen and membrane. In the tumor microenvironment, it is found to be present in the plasma membrane. The gene encoding this protein is localized on human chromosome Xq24.
Immunogen
LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Application
Monoclonal Anti-LAMP2 antibody produced in mouse has been used in immunofluorescence.
Biochem/physiol Actions
Lysosome-associated membrane protein 2 (LAMP2) protects lysosomal membranes from acid proteolysis. It serves as an acidity biomarker in spheroids and xenografts.The protein also has a role in maturation of autophagic vacuoles and cell-cell or cell-extracellular matrix adhesion. Mutation in the LAMP2 gene has been linked to cardiomyopathy in young patients.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Primary LAMP-2 deficiency causes X-linked vacuolar cardiomyopathy and myopathy (Danon disease)
Nature Genetics (1999)
A Crucial Sequence for Transglutaminase Type 2 Extracellular Trafficking in Renal Tubular Epithelial Cells Lies in Its N-terminal ?-Sandwich Domain
Che-Yi
The Journal of Biological Chemistry (2011)
Clinical outcome and phenotypic expression in LAMP2 cardiomyopathy
Barry Maron
JAMA : The Journal of the American Medical Association (2009)
Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane.
Damaghi M
Nature Communications (2015)
Mahogunin ring finger 1 confers cytoprotection against mutant SOD1 aggresomes and is defective in an ALS mouse model
Deepak Chhangani
Neurobiology of Disease (2016)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service