Skip to Content
MilliporeSigma

MSQC18

Sigma-Aldrich

SILuLite SigmaMAb Cetuximab Monoclonal Antibody

recombinant, expressed in CHO cells

Synonym(s):

Mass spectrometry standard, Cetuximab

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
41105331
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

recombinant

expressed in CHO cells

assay

≥90% (SDS-PAGE)

form

solid

suitability

suitable for mass spectrometry

shipped in

wet ice

storage temp.

−20°C

Related Categories

General description

SigmaMAb Cetuximab (MSQC18) was designed to be a standard for the analysis of Cetuximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILuMab Cetuximab (MSQC19).

SigmaMAb Cetuximab is for R&D use only. Not for drug, household, or other uses.

Application

SILu Lite SigmaMAb Cetuximab Monoclonal Antibody has been used in isoluminol enhanced chemiluminescence assay to measure the reactive oxygen species (ROS) production from monocytes.

Other Notes

SigmaMab Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sachin Surve et al.
The Journal of cell biology, 220(11) (2021-09-14)
The subcellular localization of RAS GTPases defines the operational compartment of the EGFR-ERK1/2 signaling pathway within cells. Hence, we used live-cell imaging to demonstrate that endogenous KRAS and NRAS tagged with mNeonGreen are predominantly localized to the plasma membrane. NRAS

Articles

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Characterize mAb monomers, aggregates, and fragments using SEC-UV workflow with Zenix® and Zenix®-C SEC columns.

Related Content

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service