Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
8
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:500- 1:1000
immunogen sequence
RGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVP
UniProt accession no.
application(s)
research pathology
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TOP2A(7153)
General description
The topoisomerase II A gene (TOP2A), with 35 exons and more number of class 0 introns spanning approximately 30kb, is mapped to human chromosome 17q12-q21 in close proximity to the human epidermal growth factor receptor 2 (HER2) oncogene. The gene codes for 170-kDa protein called DNA topoisomerase 2-α. TOP2A is expressed in the nucleoplasm of cells and is characterized with C-terminal domain and catalytic domain involved in dimerization or nuclear localization.
Immunogen
TOP2A_HUMAN Isoform 2 of P11388 - Homo sapiens recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Topoisomerase II A (TOP2A) enzyme plays a vital role in DNA replication and cell proliferation. Experimental studies observed increased expression of this enzyme in chinese patients with gastric carcinoma. DNA topoisomerase 2-α acts as a target enzyme for an anthracycline drug called as epirubicin and many other antineoplastic drugs. Top2α is involved in reducing the topological stress in cells. The hsa-miR-485-3p downregulates the expression of nuclear transcription factor Y subunit β (NFYΒ), which acts as a mediator of Top2α. Consequently, it decreases the expression of Top2α and its drug responsiveness. Top2α enzyme plays an important role in maintenance of chromosome condensation and segregation. Ataxia telangiectasia mutated (ATM)-dependent regulation of TOP2A helps in TOP2 stability and also it is sensitive to TOP2 inhibitor.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST70241
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-TOP2A antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Structure and function of type II DNA topoisomerases.
Watt PM, Hickson ID
The Biochemical Journal, 303 (pt 3) , 681-695 (1994)
Analysis of EGFR, HER2, and TOP2A gene status and chromosomal polysomy in gastric adenocarcinoma from Chinese patients.
Liang Z
BMC Cancer, 8:363s (2008)
TOP2A and HER-2 gene amplification in fine needle aspirates from breast carcinomas.
Bofin AM
Cytopathology : Official Journal of the British Society For Clinical Cytology, 14(6), 314-319 (2003)
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA026773-100UL | 04061836290399 |
| HPA026773-25UL | 04061842852031 |