AV48204
Anti-ENO3 (AB1) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Enolase 3 (β, muscle), Anti-MSE
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
47 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ENO3(2027)
Related Categories
General description
Enolase 3 (ENO3) is a skeletal muscle isoenzyme that is involved in muscle development. ENO3 transcription is regulated by muscle-specific enhancer proteins. Mutations in ENO3 have been linked to glycogen storage diseases.
Rabbit Anti-ENO3 antibody recognizes bovine, canine, rabbit, human, mouse, and rat ENO3.
Rabbit Anti-ENO3 antibody recognizes bovine, canine, rabbit, human, mouse, and rat ENO3.
Immunogen
Synthetic peptide directed towards the N terminal region of human ENO3
Application
Rabbit Anti-ENO3 antibody is suitable for western blot applications at a concentration of 0.25μg/ml.
Biochem/physiol Actions
ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Michael Lutter et al.
Biological psychiatry, 81(9), 770-777 (2016-11-26)
While eating disorders (EDs) are thought to result from a combination of environmental and psychological stressors superimposed on genetic vulnerability, the neurobiological basis of EDs remains incompletely understood. We recently reported that a rare missense mutation in the gene for
S Feo et al.
Molecular and cellular biology, 15(11), 5991-6002 (1995-11-01)
To provide evidence for the cis-regulatory DNA sequences and trans-acting factors involved in the complex pattern of tissue- and stage-specific expression of the beta enolase gene, constructs containing fragments of the gene fused to the chloramphenicol acetyltransferase gene were used
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service