AV33096
Anti-HSPA1A antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Heat shock 70 kDa protein 1A
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
52 kDa
species reactivity
bovine, goat, guinea pig, dog, human, sheep, rat, horse, rabbit, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HSPA1A(3303)
General description
Heat shock 70 kDa protein 1A (HSPA1A, eHSP70, HSP72) is an environmental stress-inducible extracellular/plasma circulating heat shock protein that interacts with effector cells of the innate immune system. HSPA1A promotes the proliferation of H22 hepatocarcinoma cells through TLR2 and TLR4 signaling. HSPAIA signaling via TLR4 may trigger O3-induced lung inflammation. HSPA1A and its in vivo antibodies may contribute to the development of atherosclerosis. HSPA1A may stimulate innate and adaptive proinflammatory immune responses.
Immunogen
Synthetic peptide directed towards the middle region of human HSPA1A
Application
Rabbit polyclonal anti- HSPA1A antibody is used to tag plasma circulating 70 kDa heat shock protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of plasma circulating 70 kDa heat shock proteins in the activation of cells containing TLR2 and TLR4 receptors, the stimulation of proinflammatory immune responses and the development of atherosclerosis.
Biochem/physiol Actions
HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.
Rabbit polyclonal anti- HSPA1A antibody reacts with zebrafish, human, mouse, rat, Caenorhabditis elegans, and canine plasma circulating 70 kDa heat shock proteins.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Ziliang Ji et al.
Reproduction (Cambridge, England), 147(5), 693-701 (2014-02-01)
Hyperthermia and oxidative stresses are the two central elements contributing to varicocele-related sperm damage. Growing evidence indicates that microRNAs (miRNAs) are involved in the regulation of the heat and oxidative stress responses. In this study, we analyzed the expressions of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service