Skip to Content
MilliporeSigma

AV32762

Sigma-Aldrich

Anti-PIAS3 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Protein inhibitor of activated STAT, 3

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

67 kDa

species reactivity

horse, human, bovine, rat, dog, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PIAS3(10401)

General description

PIAS3 is a transcription factor that facilitates protein SUMOylation. It inhibits STAT3-mediated signaling and studies have reported that its overexpression can induce apoptosis in prostate cancer cells. PIAS3 can also function as a biomarker for human cancer.
Rabbit Anti-PIAS3 antibody recognizes human, rat, canine, mouse, and bovine PIAS3.

Immunogen

Synthetic peptide directed towards the C terminal region of human PIAS3

Application

Rabbit Anti-PIAS3 antibody can be used for western blot (1.0-2.0 μg/ml) and IHC (4-8 μg/ml) applications.

Biochem/physiol Actions

PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Liming Wang et al.
Oncology reports, 11(6), 1319-1324 (2004-05-13)
STAT3 mediated signaling pathways can be inhibited by PIAS3 (protein inhibitor of activated STAT3), which was recently found to regulate protein stability and function by its SUMO (small-ubiquitin like modifiers) ligase activity in promoting sumoylation of important nuclear proteins. Over-expression
Qi Jiang et al.
Biochemical and biophysical research communications, 449(3), 278-283 (2014-05-27)
Atrial fibrillation (AF) is progressive and is the most common clinical arrhythmia. It is associated with inflammatory changes characterized by signal transducer and activator of transcription 3 (STAT3) signaling. A zinc finger homeobox 3 (ZFHX3, also named AT-motif binding factor

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service