AV13040
Anti-GRIK4 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Glutamate receptor, ionotropic, kainate 4
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
107 kDa
species reactivity
mouse, human, rabbit, dog, pig, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GRIK4(2900)
Immunogen
Synthetic peptide directed towards the N terminal region of human GRIK4
Application
Anti-GRIK4 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
GRIK4 or glutamate receptor 4 receptor subunit modulates the synaptic transmission and cellular excitability in the brain. Mutations in GRIK4 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Olivier Cases et al.
Biochimica et biophysica acta, 1863(6), 1242-1254 (2017-04-04)
High myopia (HM) is one of the main causes of visual impairment and blindness all over the world and an unsolved medical problem. Persons with HM are predisposed to other eye pathologies such as retinal detachment, myopic retinopathy or glaucomatous
Cleo S Bonnet et al.
JCI insight, 5(13) (2020-06-17)
Musculoskeletal disorders represent the third greatest burden in terms of death and disability in the developed world. Osteoarthritis is the single greatest cause of chronic pain, has no cure, and affects 8.5 and 27 million people in the UK and
Sonja Horstmann et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 35(3), 727-740 (2009-11-20)
Single-nucleotide polymorphisms (SNPs) in the FKBP5, GRIK4, and HTR2A genes have been shown to be associated with response to citalopram treatment in the STAR(*)D sample, but only associations with FKBP5 have so far been tested in the Munich Antidepressant Response
Justin S Catches et al.
Behavioural brain research, 228(2), 406-414 (2011-12-29)
There is a clear link between dysregulation of glutamatergic signaling and mood disorders. Genetic variants in the glutamate receptor gene GRIK4, which encodes the kainate receptor subunit GluK4, alter the susceptibility for depression, bipolar disorder and schizophrenia. Here we demonstrate
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service