AMAB91372
Monoclonal Anti-PAX6 antibody produced in mouse
Prestige Antibodies® Powered by Atlas Antibodies, clone CL5414, purified immunoglobulin, buffered aqueous glycerol solution
Synonym(s):
AN, AN2, D11S812E, WAGR
Select a Size
About This Item
conjugate
unconjugated
Quality Level
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
CL5414, monoclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse, rat
technique(s)
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:500-1:1000
isotype
IgG1
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PAX6(5080)
Related Categories
Immunogen
Sequence
VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
Application
Features and Benefits
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Other Notes
Legal Information
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Articles
Stem cell markers, including embryonic stem cell, pluripotency, transcription factors, induced PSCs, germ cells, ectoderm, and endoderm markers.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service