AV31855
Anti-GATA2 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-GATA binding protein 2
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
50 kDa
species reactivity
rabbit, rat, guinea pig, dog, bovine, human, horse, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GATA2(2624)
General description
GATA binding protein 2 (GATA2) is a transcription factor involved in the regulation of ematopoiesis wherein it is essential for the regulation of myeloid lineage determination. GATA2 is required for normal megakaryocyte development and it is a negative regulator of hematopoietic stem/progenitor cell differentiation. GATA2 is a novel poor prognostic marker in pediatric AML.
Rabbit polyclonal anti-GATA2 antibody reacts with canine, chicken, bovine, pig, human, mouse, and rat GATA binding protein 2 transcription factors.
Immunogen
Synthetic peptide directed towards the N terminal region of human GATA2
Application
Rabbit Anti-GATA2 antibody can be used for western blot assays (1-2μg/ml) and immunohistochemical (4-8μg/ml, using paraffin embedded tissues) applications.
Rabbit polyclonal anti-GATA2 antibody is used to tag GATA binding protein 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GATA binding protein 2 in myeloid lineage determination, megakaryocyte development and hematopoietic stem/progenitor cell differentiation.
Biochem/physiol Actions
The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Song Shen et al.
Molecular pharmaceutics, 11(8), 2612-2622 (2014-02-14)
Synthetic lethal interaction provides a conceptual framework for the development of wiser cancer therapeutics. In this study, we exploited a therapeutic strategy based on the interaction between GATA binding protein 2 (GATA2) downregulation and the KRAS mutation status by delivering
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service