WH0004282M1
Monoclonal Anti-MIF antibody produced in mouse
clone 2A10-4D3, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-GIF, Anti-GLIF, Anti-MMIF, Anti-macrophage migration inhibitory factor (glycosylation-inhibiting factor)
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2A10-4D3, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
glycosylation
유전자 정보
human ... MIF(4282)
일반 설명
Macrophage migration inhibitory factor (MIF) is a 37.5kDa homotrimer protein. It is expressed in various cells like monocytes, macrophages, vascular smooth muscle cells (SMCs) and cardiomyocytes. This gene is located on human chromosome 21q22.33.(1)
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. (provided by RefSeq)
면역원
MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
생화학적/생리학적 작용
Macrophage migration inhibitory factor (MIF) can induce inflammation. Aberrations in MIF result in several inflammatory diseases, such as ulcerative colitis (UC), psoriasis and tuberculosis (TB).(1) It controls the anti-inflammator effects of glucocorticoids. MIF plays pro-inflammatory roles in inflammatory diseases like rheumatoid arthritis, sepsis, acute respiratory distress syndrome and glomerulonephritis.(2)
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Macrophage migration inhibitory factor promoter polymorphisms (-794 CATT5-8): Relationship with soluble MIF levels in coronary atherosclerotic disease subjects
Qian L, et al.
BMC Cardiovascular Disorders, 17(1) (2017)
A functional promoter polymorphism in the macrophage migration inhibitory factor (MIF) gene associated with disease severity in rheumatoid arthritis
Baugh JA, et al.
Genes and Immunity, 3(3), 170-176 (2002)
Juneo Freitas Silva et al.
Reproduction (Cambridge, England), 147(6), 803-816 (2014-02-19)
The objective of the present study was to evaluate the gene and immunohistochemical expression of inflammatory mediators involved in the immune activity and the intrauterine trophoblast migration of the placentas in hypothyroid and L-thyroxine (L-T4)-treated rats. A total of 144
Dake Qi et al.
The Journal of clinical investigation, 124(8), 3540-3550 (2014-07-02)
The cellular response to stress involves the recruitment and coordination of molecular signaling pathways that prevent cell death. D-dopachrome tautomerase (DDT) is an enzyme that lacks physiologic substrates in mammalian cells, but shares partial sequence and structural homology with macrophage
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.