HPA040361
Anti-CX3CL1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-Abcd-3, Anti-C3xkine, Anti-Chemokine (c-x3-c motif) ligand 1, Anti-Cxc3, Anti-Cxc3c, Anti-Fractalkine, Anti-Neurotactin, Anti-Ntn, Anti-Scyd1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:500- 1:1000
면역원 서열
GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CX3CL1(6376)
일반 설명
C-X3-C motif chemokine ligand 1(CX3CL1), also known as fractalkine (FKN), is encoded by the gene mapped to human chromosome 16q21. The encoded protein acts as a chemotactic cytokine in a soluble form, or acts as a binding molecule in a membrane-attached form. CX3CL1 is characterized by a mucin-like stalk containing chemokine domain and single transmembrane domain with a short intracellular C-terminal. CX3CL1 belongs to the CX3C chemokine subfamily.
면역원
chemokine (C-X3-C motif) ligand 1 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-CX3CL1 antibody produced in rabbit has been used in tissue microarray (TMA) immunostaining.
생화학적/생리학적 작용
CX3CL1 interacts with its cognate receptor CX3CR1 and stimulates chemotaxis of macrophages to apoptotic lymphocytes. The protein also facilitates inflammatory processes in the central nervous system (CNS). CX3CL1 has been implicated in the molecular mechanism that controls cell adhesion, migration and survival of human prostate cancer cells. Hence, the protein has potential therapeutic approach to treatment of prostate cancer. Elevated expression of serum CX3CL1 has been observed in postmenopausal osteoporotic patients. Thus, it acts as a potential diagnostic marker and therapeutic target for anti-resorptive treatment in osteoporosis patients.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
기타 정보
Corresponding Antigen APREST81765
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
WangMi Liu et al.
Archivum immunologiae et therapiae experimentalis, 64(5), 371-383 (2016-04-22)
Chemokines are a family of small 8-10 kDa inducible cytokines. Initially characterized as chemotactic factors, they are now considered to affect not just cellular recruitment. CX3CL1 is a unique chemokine that can exist in a soluble form, as a chemotactic cytokine
Lucy A Truman et al.
Blood, 112(13), 5026-5036 (2008-09-19)
Cells undergoing apoptosis are efficiently located and engulfed by phagocytes. The mechanisms by which macrophages, the professional scavenging phagocytes of apoptotic cells, are attracted to sites of apoptosis are poorly defined. Here we show that CX3CL1/fractalkine, a chemokine and intercellular
Yi-Ding Chen et al.
British journal of biomedical science, 73(3), 121-128 (2016-08-02)
The chemokine (C-X3-C motif) ligand 1 (CX3CL1), also called fractalkine (FKN), has recently been reported to be involved in osteoclastogenic process and pathological bone destruction. This study aimed to investigate the link between serum CX3CL1/FKN levels with disease progression of
Gladys Morrison et al.
Stem cell research, 16(1), 140-148 (2016-01-17)
Differentiated cells retain the genetic information of the donor but the extent to which phenotypic differences between donors or batches of differentiated cells are explained by variation introduced during the differentiation process is not fully understood. In this study, we
Jiebing Tang et al.
Oncology reports, 35(2), 1153-1162 (2016-01-01)
Epithelial-to-mesenchymal transition (EMT) endows cancer cells with enhanced invasive and metastatic potential during cancer progression. Fractalkine, also known as chemokine (C-X3-C motif) ligand 1 (CX3CL1), the only member recognized so far that belongs to the CX3C chemokine subfamily, was reported
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.