HPA037470
Anti-DNAH5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-CILD3, Anti-Dnahc5, Anti-Dynein, axonemal, heavy chain 5, Anti-HL1, Anti-KTGNR, Anti-PCD
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunohistochemistry: 1:500-1:1000
면역원 서열
EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human  ...  DNAH5(1767)   
일반 설명
The gene DNAH5 (dynein axonemal heavy chain 5) is mapped to human chromosome 5p15.3. It is a component of the microtubule-linked motor protein complex.
면역원
dynein, axonemal, heavy chain 5 recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols  and other useful information.
Anti-DNAH5 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Anti-DNAH5 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
생화학적/생리학적 작용
DNAH5 (dynein axonemal heavy chain 5) is an axonemal heavy chain dynein protein. With the help of the ATPase activity, this protein works as a force generator in respiratory cilia. Mutation in this gene is linked with primary ciliary dyskinesia (PCD) type 3 and Kartagener syndrome. In chronic obstructive pulmonary disease, DNAH5 is associated with total lung capacity and regulates hyperinflation. 
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
기타 정보
Corresponding Antigen APREST79923
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
Christine P Diggle et al.
PLoS genetics, 10(9), e1004577-e1004577 (2014-09-19)
Cilia are highly conserved microtubule-based structures that perform a variety of sensory and motility functions during development and adult homeostasis. In humans, defects specifically affecting motile cilia lead to chronic airway infections, infertility and laterality defects in the genetically heterogeneous
DNAH5 is associated with total lung capacity in chronic obstructive pulmonary disease.
Lee JH, et al. 
Respiratory Research, 15, 97-97 (2014)
Application of SNP microarrays to the genome-wide analysis of chromosomal instability in premalignant airway lesions.
Nakachi I, et al. 
Cancer Prevention Research (Philadelphia, Pa.), 7, 255-265 (2014)
HEATR2 plays a conserved role in assembly of the ciliary motile apparatus.
Diggle CP, et al. 
PLoS Genetics, 10, e1004577-e1004577 (2014)
Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects.
Onoufriadis A, et al. 
Human Molecular Genetics, 23, 3362-3374 (2014)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.