AV39844
Anti-MAX antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-MGC10775, Anti-MGC11225, Anti-MGC18164, Anti-MGC34679, Anti-MGC36767, Anti-MyC associated factor X, Anti-Orf1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
17 kDa
종 반응성
human, pig, mouse, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human  ...  MAX(4149)   
일반 설명
MyC associated factor X (MAX), Myc and Mad are basic helix-loop-helix leucine zipper transcription factors that bind to a specific hexanucleotide element of DNA, the E-box (CACGTG).  Myc and Mad form heterodimers with Max to become active regulators of transcription. Myc:Max and Mad:Max heterodimers form higher order complexes that regulate a wide range of cell processes at the level of transcription. Myc:Max and Mad:Max dimerizations are regulatory control points for many myc and mad mediated cell processes.
면역원
Synthetic peptide directed towards the n terminal region of human MAX
애플리케이션
Anti-MAX polyclonal antibody is used to tag MyC associated factor X protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of myC associated factor X in the regulation of RNA transcription especially in association with myc or mad transcription factors.
생화학적/생리학적 작용
Anti-MAX polyclonal antibody reacts with human, mouse, rat, chicken, canine, and zebrafish myC associated factor X proteins.
MAX is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation.The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full length nature for some of them is unknown.The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature for some of them is unknown.
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
기타 정보
Synthetic peptide located within the following region:  MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.