Skip to Content
Merck

WH0136371M2

Sigma-Aldrich

Monoclonal Anti-ASB10 antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ankyrin repeat and SOCS box-containing 10

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F3, monoclonal

form

buffered aqueous solution

species reactivity

rat, human, mouse

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ASB10(136371)

General description

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. The SOCS box serves to couple suppressor of cytokine signaling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene. (provided by RefSeq)

Immunogen

ASB10 (NP_001135931, 48 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW

Biochem/physiol Actions

ASB10 (ankyrin repeat and SOCS box containing 10) plays a vital role in the ubiquitination-mediated proteasomal and autophagy-lysosomal degradation pathways. The ANK repeat containing domain is responsible for protein-protein interactions whereas the SOCS (suppressor of cytokine signaling) box motif helps in ubiquitination of the protein by binding to the multisubunit E3 ubiquitin ligase complex. ASB family interacts specifically with Cul5-Rbx2 in cells to form an E3 ubiquitin (Ub) ligase complex.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Junya Kohroki et al.
FEBS letters, 579(30), 6796-6802 (2005-12-06)
The ankyrin repeat and SOCS box (ASB) family is composed of 18 proteins from ASB1 to ASB18 and belongs to the suppressor of cytokine signaling (SOCS) box protein superfamily. ASB2 was recently shown to interact with a certain Cul-Rbx module

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service