SAB5702842
Anti-PGAM1 Antibody, clone 7V9H9, Rabbit Monoclonal
Synonym(s):
HEL-S-35, PGAM-B, PGAMA
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.46
biological source
rabbit
Quality Level
conjugate
unconjugated
material
colorless
clone
7V9H9, monoclonal
form
liquid
mol wt
28 kDa
species reactivity
rat, rat, human
concentration
0.83mg/mL
technique(s)
immunohistochemistry: 1:50 - 1:200
western blot: 1:500 - 1:2000
color
colorless
isotype
IgG
immunogen sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNK
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PGAM1(5223)
General description
The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGAM1 (P18669).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.
Application
WB, IHC
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service