Skip to Content
Merck

SAB5702122

Sigma-Aldrich

Anti-WAVE2/WASF2 Antibody, clone 7A6C10, Rabbit Monoclonal

Synonym(s):

IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.46
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

material

colorless

clone

7A6C10, monoclonal

form

liquid

mol wt

80 kDa

species reactivity

rat, rat, human

concentration

2 mg/mL

technique(s)

immunohistochemistry: 1:50 - 1:200
western blot: 1:500 - 1:2000

color

colorless

isotype

IgG

immunogen sequence

PPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WASF2(10163)

General description

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service