Skip to Content
Merck

SAB1405127

Sigma-Aldrich

Monoclonal Anti-EXOSC4, (N-terminal) antibody produced in mouse

clone 4F9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4F9, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EXOSC4(54512)

General description

Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
The gene EXOSC4 (exosome component 4) is mapped to human chromosome 8q24.3. The encoded protein is present in the cytoplasm as well as nucleus and has a RNase pleckstrin homology (PH) domain.

Immunogen

EXOSC4 (NP_061910.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG

Biochem/physiol Actions

EXOSC4 (exosome component 4) is a core component of the exosome complex and is required for the stability of the complex. The exosome complex exhibits 3′-5′ exoribonuclease function. EXOSC4 lacks ribonuclease activity but is involved in mRNA turnover.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

John R Anderson et al.
RNA (New York, N.Y.), 12(10), 1810-1816 (2006-08-17)
We have previously demonstrated that PM-Scl-75, a component of the human exosome complex involved in RNA maturation and mRNA decay, can specifically interact with RNAs containing an AU-rich instability element. Through the analysis of a series of deletion mutants, we
Chang Ohk Sung et al.
Cancer genetics, 206(5), 145-153 (2013-06-04)
Ovarian clear cell adenocarcinoma (Ov-CCA) is a distinctive subtype of ovarian epithelial carcinoma. In this study, we performed array comparative genomic hybridization (aCGH) and paired gene expression microarray of 19 fresh-frozen samples and conducted integrative analysis. For the copy number
Uttiya Basu et al.
Cell, 144(3), 353-363 (2011-01-25)
Activation-induced cytidine deaminase (AID) initiates immunoglobulin (Ig) heavy-chain (IgH) class switch recombination (CSR) and Ig variable region somatic hypermutation (SHM) in B lymphocytes by deaminating cytidines on template and nontemplate strands of transcribed DNA substrates. However, the mechanism of AID
Erwin L van Dijk et al.
RNA (New York, N.Y.), 13(7), 1027-1035 (2007-06-05)
The human exosome is a 3'-5' exoribonuclease complex that functions both in the nucleus and in the cytoplasm to either degrade or process RNA. Little is known yet about potential differences among core exosome complexes in these different cellular compartments

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service