WH0008192M1
Monoclonal Anti-CLPP antibody produced in mouse
clone 300, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
300, monoclonal
form
buffered aqueous solution
species reactivity
rat, human, mouse
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CLPP(8192)
Related Categories
General description
CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) protein contains an aqueous chamber formed by face-to-face assembly of the two heptameric rings that have proteolytic active sites within. It is a member of the peptidase family S14. The CLPP gene is localized to human chromosome 19p13.3.
Immunogen
CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Application
Monoclonal Anti-CLPP antibody produced in mouse has been used in Western Blotting.
Biochem/physiol Actions
CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) gene encodes a protease component of the Clp complex that hydrolyzes peptides and various proteins in the presence of ATP. The protein requires magnesium for its activity. CLPP is found to be associated with the inner mitochondrial membrane.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Gavin Pharaoh et al.
Redox biology, 8, 430-438 (2016-05-22)
Mice deficient in the electron transport chain (ETC) complex IV assembly protein SURF1 have reduced assembly and activity of cytochrome c oxidase that is associated with an upregulation of components of the mitochondrial unfolded protein response (UPR(MT)) and increased mitochondrial
Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP
Sung Gyun Kang
Journal of Structural Biology, 148 (2004)
Perrault syndrome is caused by recessive mutations in CLPP, encoding a mitochondrial ATP-dependent chambered protease
Emma M Jenkinson
American Journal of Human Genetics, 92 (2013)
Ablation of the mitochondrial complex IV assembly protein Surf1 leads to increased expression of the UPRMT and increased resistance to oxidative stress in primary cultures of fibroblasts
Gavin Pharaoh
Redox Biology (2016)
Shylesh Bhaskaran et al.
EMBO reports, 19(3) (2018-02-09)
Caseinolytic peptidase P (ClpP) is a mammalian quality control protease that is proposed to play an important role in the initiation of the mitochondrial unfolded protein response (UPRmt), a retrograde signaling response that helps to maintain mitochondrial protein homeostasis. Mitochondrial
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service