Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
8
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence
FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GGH(8836)
General description
The gene GGH (γ-glutamyl hydrolase) is mapped to human chromosome 8q12.1. The protein is mainly present in the lysosomes.
Immunogen
Gamma-glutamyl hydrolase Precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-GGH antibody produced in rabbit has been used for immunohistochemistry and western blotting.
Anti-GGH antibody produced in rabbit has been used for immunohistochemistry and western blotting.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
GGH (γ-glutamyl hydrolase) is involved in the removal of γ-linked polyglutamates, thereby hydrolysing (anti)folylpoly-γ-glutamates. The enzyme controls the intracellular folate pools and folate metabolism. During the treatment of acute lymphoblastic leukemia (ALL), mutation in the GGH gene is linked with efficacy and side effects of methotrexate (MTX). It is responsible for changing a long-chain methotrexate polyglutamates (MTX-PGs) into a short-chain MTX-PGs and finally to MTX. Mutation in this gene at -401C>T enhances the response of cisplatin-based chemoradiotherapy in cervical carcinoma. The levels of GGH are higher in invasive breast cancer tumors and are associated with the development and progression of the cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST74642
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Proteomic analysis of human substantia nigra identifies novel candidates involved in Parkinson's disease pathogenesis.
Licker V, et al.
Proteomics, 14, 784-794 (2014)
Nathaniel Melling et al.
International journal of molecular sciences, 18(2) (2017-02-02)
γ-glutamyl-hydrolase (GGH) is a ubiquitously-expressed enzyme that regulates intracellular folate metabolism for cell proliferation, DNA synthesis, and repair. Employing GGH immunohistochemistry on a tissue microarray with 12,427 prostate cancers, we found that GGH expression was negative to low in normal
Identification of carboxypeptidase E and gamma-glutamyl hydrolase as biomarkers for pulmonary neuroendocrine tumors by cDNA microarray.
He P, et al.
Human Pathology, 35, 1196-1209 (2004)
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA025226-100UL | 04061836289225 |
| HPA025226-25UL | 04061842848294 |