콘텐츠로 건너뛰기
Merck

HPA005480

Sigma-Aldrich

Anti-SYVN1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-DER3, Anti-HRD1

로그인조직 및 계약 가격 보기

크기 선택


제품정보 (DICE 배송 시 비용 별도)

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43
기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의
기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

기술

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SYVN1(84447)

일반 설명

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) is a part of ER-associated degradation (ERAD) and is an E3 ubiquitin ligase. It localizes to endoplasmic reticulum (ER) and is ubiquitously expressed. It is highly expressed in skeletal muscle, pancreas and liver. SYVN1 contains six domains, which span the plasma membrane. It is a non-glycosylated protein and has a cytoplasmic RING-H2 finger domain. This gene is located on chromosome 11q13.

면역원

E3 ubiquitin-protein ligase synoviolin precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SYVN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) plays a key role in various processes, such as embryogenesis or negative regulation of tumor suppressor gene p53. The expression of SYVN1 is induced by IRE1 and ATF6, during ER stress, where it protects against ER-stress induced cell apoptosis. It is a part of endoplasmic reticulum associated degradation (ERAD) and degrades 3-hydroxy-3-methylglutaryl-coenzyme A, along with TCR-α and CD3-δ, which are ERAD substrates. It also sequesters p53, in the cytoplasm, and ubiquitinates it. Thus, it represses the various activities of p53, such as cell cycle regulation and apoptosis. SYVN1 is responsible for maintaining joint homeostasis and hence, is involved in the pathogenesis of arthropathy. In rheumatoid arthritis, it is overexpressed in synovial cells, leading to a ′hyper-ERAD′ state. It interacts with, and degrades tau and phosphorylated tau (p-tau). Therefore, it prevents tau-induced cytotoxicity and helps neuronal survival.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

기타 정보

Corresponding Antigen APREST70751

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Y X Shen et al.
Current molecular medicine, 12(2), 138-152 (2012-01-28)
Intraneuronal accumulation of abnormal phosphorylated tau (p-tau) is a molecular pathology in many neurodegenerative tauopathies, including Alzheimer's disease (AD) and frontotemporal dementia with parkinsonism-linked to chromosome 17 (FTDP-17). However, the underlying mechanism remains unclear. Here, we showed an inverse relationship
Naoko Yagishita et al.
Nature clinical practice. Rheumatology, 4(2), 91-97 (2008-02-01)
Rheumatoid arthritis is a disease associated with painful joints that affects approximately 1% of the population worldwide, and for which no specific cure is available. Among other functions, the endoplasmic reticulum (ER) has an important role in protein folding. When
Marjolein Kikkert et al.
The Journal of biological chemistry, 279(5), 3525-3534 (2003-11-01)
The ubiquitin system plays an important role in endoplasmic reticulum (ER)-associated degradation of proteins that are misfolded, that fail to associate with their oligomerization partners, or whose levels are metabolically regulated. E3 ubiquitin ligases are key enzymes in the ubiquitination
Masayuki Kaneko et al.
FEBS letters, 581(28), 5355-5360 (2007-10-31)
Human HRD1 and SEL1 are components of endoplasmic reticulum-associated degradation (ERAD), which is a retrograde transport mechanism from the ER to the cytosol for removing unfolded proteins. The expression of HRD1 and SEL1 was induced by ER stress-inducing agents and
Masayuki Kaneko et al.
FEBS letters, 532(1-2), 147-152 (2002-12-03)
Stresses that impair the function of the endoplasmic reticulum (ER) lead to an accumulation of unfolded protein in the ER. Under these conditions, the expression of a variety of genes involved in preventing the accumulation of the unfolded proteins is

관련 콘텐츠

Prestige Antibodies Immunofluorescence Procedure

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.